DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and AT3G01800

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_186829.3 Gene:AT3G01800 / 821076 AraportID:AT3G01800 Length:267 Species:Arabidopsis thaliana


Alignment Length:247 Identity:72/247 - (29%)
Similarity:122/247 - (49%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VRQTRVSS--SSPKLPLI----LQNNLENTKYLQVA-RDYAKGKDKKKEKGGKGKPGKVEINEQQ 70
            |.|:|..|  |||.|.::    ||.:|....:|:.: |.:|||| |.|:..|.|...........
plant    25 VVQSRDFSFISSPNLMMMGGRDLQFDLSMPDFLRDSRRGFAKGK-KSKDDSGTGMVDAAPDIGPT 88

  Fly    71 LREILNFDGLNSQMQKSVMQMKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKT 135
            ::.     ..:|||:.::..:..|..|..:.|:..|.:|.:.::..|.:..|..||.:|..:|||
plant    89 VKA-----AASSQMEAAIDALSRDLTKLRTGRAAPGMLDHIVVETGGVKMPLNHLALVSVLDPKT 148

  Fly   136 IIVNMIGFPQTIPDVLKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAI 200
            :.||... |.|:.::.|||..|.:.|||:.||..|...||.:||||.:.:.|.........:.:|
plant   149 LSVNPYD-PDTVKELEKAIVASPLGLNPKLDGQRLVASIPALTKEHIQAMCKIVTKSSEVVKQSI 212

  Fly   201 RGVQNEHIRKLKKQ-PELGKDDAFAAQAQVTAIADRFISEADKLLASKQKEL 251
            |..:.:.:..:||. ..|.||:....:.:|..:..:|:..|:.:..||:||:
plant   213 RRARQKALDTIKKAGSSLPKDEVKRLEKEVDELTKKFVKSAEDMCKSKEKEI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 51/177 (29%)
AT3G01800NP_186829.3 RRF 108..264 CDD:280019 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3109
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I2305
OMA 1 1.010 - - QHG62479
OrthoDB 1 1.010 - - D1472838at2759
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - otm2546
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - O PTHR20982
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.