DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and mrrf

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001072392.1 Gene:mrrf / 779846 XenbaseID:XB-GENE-1008997 Length:252 Species:Xenopus tropicalis


Alignment Length:252 Identity:85/252 - (33%)
Similarity:143/252 - (56%) Gaps:4/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRSALHLAALGVRQTRVSSSSPKLPLILQNNLENTKYLQVARDYAKGKDKKKEKGGKGKPGKVEI 66
            ||....|..:.:.....:|..|:...:...:.|:: ...::|..|..|.|.|.||  ....:|.:
 Frog     3 LRCLCRLQPVALHFRTATSLGPQRSALAVKSQEHS-IAFISRHLATKKSKAKSKG--QVQARVNL 64

  Fly    67 NEQQLREILNFDGLNSQMQKSVMQMKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRK 131
            |...:.:|:|.:.:..:|:..:..:||||.|:||:|::.||.|.:.:.....:..|.:|.|||.|
 Frog    65 NAALVEDIINLEDVKQEMKSILENLKEDFTKNLSIRTSPGAFDHITVTTKDGKFPLNQLGQISLK 129

  Fly   132 NPKTIIVNMIGFPQTIPDVLKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKY 196
            :|:..|:||..||::....:.|:..|.|||||:.|||.:.:|:|:||:||||||:|.||.|..|.
 Frog   130 SPQLFIINMASFPESATAAVNALRDSQMNLNPELDGTIIRVPVPQVTREHRENLTKLAKQLTNKA 194

  Fly   197 RDAIRGVQNEHIRKLKKQPE-LGKDDAFAAQAQVTAIADRFISEADKLLASKQKELL 252
            :|::|..:...::::||..| :.:|.....:.|:..:||...:|.||.||:|.||||
 Frog   195 KDSLRKARTGAVQEVKKCKEGVSEDIVKLLEKQIQQMADDIATELDKQLATKTKELL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 67/176 (38%)
mrrfNP_001072392.1 RRF 89..250 CDD:396363 64/160 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5169
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12203
Inparanoid 1 1.050 148 1.000 Inparanoid score I4299
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472838at2759
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - oto103640
Panther 1 1.100 - - LDO PTHR20982
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2772
SonicParanoid 1 1.000 - - X5763
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.