DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and Mrrf

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_080698.1 Gene:Mrrf / 67871 MGIID:1915121 Length:262 Species:Mus musculus


Alignment Length:239 Identity:84/239 - (35%)
Similarity:138/239 - (57%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RVSSSSPKLPLILQNNLENTKYLQVARDYAKGKDKKKEKGGKGKP-GKVEINEQQLREILNFDGL 80
            |..|:.|.:|:               |.:|..|.|.|   |||:| .:|.:|...:.:|::.:.:
Mouse    42 RQYSAYPAVPV---------------RHFATKKAKAK---GKGQPQARVTVNRALVEDIISLEEV 88

  Fly    81 NSQMQKSVMQMKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKTIIVNMIGFPQ 145
            :..|:..|..:|::|.|.|::|:..|::|.:.:.....:..|.::.|||.|:|:.|:|||..||:
Mouse    89 DEDMKSVVEALKDNFNKTLNIRTAPGSLDHITVVTADGKVALNQIGQISMKSPQVILVNMASFPE 153

  Fly   146 TIPDVLKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAIRGVQNEHIRK 210
            .....:|||.:|||||||:.:||.:.:||||||:||||.|.|.||....|.::.:|.|:...:.|
Mouse   154 CTAAAIKAIRESGMNLNPEVEGTLIRVPIPKVTREHREMLVKLAKQNTNKAKENLRKVRTNAMNK 218

  Fly   211 LKKQPELGKDDAF-AAQAQVTAIADRFISEADKLLASKQKELLG 253
            |||..:...:|.. ..:.|::.:||..::|.|:.||:|.|||||
Mouse   219 LKKSKDKTSEDTIRLIEKQISQMADDTVAELDQHLAAKTKELLG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 65/176 (37%)
MrrfNP_080698.1 RRF 99..260 CDD:396363 62/160 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833369
Domainoid 1 1.000 124 1.000 Domainoid score I5530
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12203
Inparanoid 1 1.050 144 1.000 Inparanoid score I4426
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62479
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - oto93406
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2772
SonicParanoid 1 1.000 - - X5763
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.