DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and T20F5.8

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001122520.2 Gene:T20F5.8 / 6418602 WormBaseID:WBGene00077599 Length:152 Species:Caenorhabditis elegans


Alignment Length:88 Identity:23/88 - (26%)
Similarity:32/88 - (36%) Gaps:26/88 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LAQISRKNPKTIIVNMIGFPQTIPDVLKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNA 189
            |..|:..|||.:.|.    |...|.||.....|...|:               |:|:.:     |
 Worm    67 LVVINFPNPKRVHVE----PFETPTVLNITTFSEETLS---------------TEEYAQ-----A 107

  Fly   190 KALFVKYRDAI--RGVQNEHIRK 210
            ..|.||....:  .||.:|.||:
 Worm   108 FELAVKNDQLVLPTGVSSETIRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 23/88 (26%)
T20F5.8NP_001122520.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.