DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and Mrrf

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001008355.1 Gene:Mrrf / 311903 RGDID:1305897 Length:262 Species:Rattus norvegicus


Alignment Length:237 Identity:87/237 - (36%)
Similarity:140/237 - (59%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSSPKLPLILQNNLENTKYLQVARDYAKGKDKKKEKGGKGKP-GKVEINEQQLREILNFDGLNSQ 83
            |:.|.:|:               |.:|..|.|.|   |||:| .:|.||...:.:|::.:.::..
  Rat    45 SAHPAVPV---------------RQFATKKAKAK---GKGQPQARVNINTALVEDIISLEEVDED 91

  Fly    84 MQKSVMQ-MKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKTIIVNMIGFPQTI 147
            | ||||: :|::|.|.|::|:..|::|.:.:.....:..|.::.|||.|:|:.|:|||..||:..
  Rat    92 M-KSVMEALKDNFNKTLNIRTAPGSLDHITVVTADGKLALNQIGQISMKSPQLILVNMASFPECT 155

  Fly   148 PDVLKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAIRGVQNEHIRKLK 212
            ...:|||.:|||||||:.:||.:.:||||||:||||.|.|.||....|.::.:|.|:...:.|||
  Rat   156 AAAIKAIRESGMNLNPEVEGTLIRVPIPKVTREHREMLVKLAKQNTNKAKENLRKVRTNAMNKLK 220

  Fly   213 KQPELGKDDAF-AAQAQVTAIADRFISEADKLLASKQKELLG 253
            |..:...:|.. ..:.|::.:||..::|.|:.||:|.|||||
  Rat   221 KSKDKTSEDTIRLIEKQISQMADDTVAELDRHLAAKTKELLG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 68/177 (38%)
MrrfNP_001008355.1 RRF 99..260 CDD:396363 62/160 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336925
Domainoid 1 1.000 124 1.000 Domainoid score I5412
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12203
Inparanoid 1 1.050 144 1.000 Inparanoid score I4359
OMA 1 1.010 - - QHG62479
OrthoDB 1 1.010 - - D1472838at2759
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - oto96948
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5763
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.