DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and rrf1

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_595442.1 Gene:rrf1 / 2540194 PomBaseID:SPBC1709.09 Length:244 Species:Schizosaccharomyces pombe


Alignment Length:234 Identity:54/234 - (23%)
Similarity:95/234 - (40%) Gaps:54/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AKGKDKKKE----------KGGKGKPGKVEINEQQLREILNFDGLNSQMQKSVM--------QMK 92
            ||.||.|.:          |..|....|:::..::|.:         :.|::|:        |::
pombe    38 AKDKDVKHDHDPEFANSFNKMLKSFEAKMQLVHEKLAK---------RFQEAVVLPSQGNFTQLE 93

  Fly    93 EDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKTIIVNMIGFPQT-IPDVLKAIEK 156
            ..|:...|            ||.......|:|:|.:|:|..:.||:.  .|... |.::|||||.
pombe    94 ALFIPSKS------------IKAPTPSRLLREIAAVSQKGSQQIIIR--PFEDVDIKNILKAIED 144

  Fly   157 S-----GMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAIRGVQNE---HIRKLKK 213
            |     ...||    .:|:.:...:.|.|.|:.|:|..:......|:.:..::.|   .|.|.||
pombe   145 SRYPFVANKLN----ASTIEVKPQRTTLESRQQLAKVLEGYAKDSREQLSAMRTELKKEIAKNKK 205

  Fly   214 QPELGKDDAFAAQAQVTAIADRFISEADKLLASKQKELL 252
            ......||.:.|:|::.......|:..|..|.|..|:::
pombe   206 SKAWTSDDCYKAEAEMQTAFKNAINLLDSGLKSALKKVI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 45/192 (23%)
rrf1NP_595442.1 Frr 52..244 CDD:223311 49/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.