DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and mrrf-1

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_491262.2 Gene:mrrf-1 / 171976 WormBaseID:WBGene00020625 Length:238 Species:Caenorhabditis elegans


Alignment Length:211 Identity:52/211 - (24%)
Similarity:103/211 - (48%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KKKEKGGKGKPGKVEIN-------EQQLREILNFDGLNSQMQKSVMQMKEDFVKHLSLRSTSGAI 108
            |||....|..|..|..|       ::.::||...:||          :.|:..:|.||:......
 Worm    34 KKKADNKKKNPPAVFSNLEENAVVQETIKEIQRVEGL----------LVEELTRHFSLKVDIRQY 88

  Fly   109 DTLRIKVD-GQEHELQELAQISRKNPKTIIVNMIGFPQTIPDVLKAIEKSGMNLNPQQDGTTLFI 172
            :.:.:|:: |::..|..:|:::.|:|..|::|....|..|.....||:||.:|:.|||:|..|::
 Worm    89 EDVMVKLENGKDKPLSMIARVTLKSPLMIMINFQDNPSAIKAAKLAIQKSTLNVTPQQEGAVLYV 153

  Fly   173 PIPKVTKEHRENLSKNAKA-LFVKYRDAIRGVQNEHIRKLKKQPELGKDDAFAAQAQVTAIADRF 236
            .:|.::||.||.::.:||. :..:|:.||..:.::..:|...:.....|:|...:..:..:....
 Worm   154 NVPPMSKERREKMASDAKGRILNEYKKAINEIYSKSDKKSSNEFSTRPDEAKKTREALLNMKHAA 218

  Fly   237 ISEADKLLASKQKELL 252
            ......|:..::|:||
 Worm   219 EQRGGLLIEERRKQLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 41/177 (23%)
mrrf-1NP_491262.2 RRF 56..234 CDD:294170 43/187 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157502
Domainoid 1 1.000 72 1.000 Domainoid score I6118
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I3835
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62479
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - oto17778
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2772
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.