DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdxk and pdxk

DIOPT Version :9

Sequence 1:NP_996031.1 Gene:Pdxk / 39066 FlyBaseID:FBgn0085484 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001072713.1 Gene:pdxk / 780170 XenbaseID:XB-GENE-5810533 Length:316 Species:Xenopus tropicalis


Alignment Length:309 Identity:140/309 - (45%)
Similarity:205/309 - (66%) Gaps:28/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSNHTGYKTFKGPVSNEKELATIFEGLE 75
            ||.|||||||.||||||.|::|||:|||:||.:|||||||||||..:||.|.|.:||..::|||:
 Frog    10 RVFSIQSHVVRGYVGNKAASFPLQVLGFEVDTVNSVQFSNHTGYNHWKGQVLNAEELQELYEGLK 74

  Fly    76 ENELLPLYSHLLTGYIGNPLFLRQVGHILKKLRQANPGLVYVCDPVMGD----NGQLYVPKELLP 136
            .|. :..|.::||||..:..||.:|..|:::|::.||.||||||||:||    .|.:|||:||||
 Frog    75 LNG-VTRYDYVLTGYNRDASFLARVVDIIQELKRQNPHLVYVCDPVLGDKWNGEGSMYVPEELLP 138

  Fly   137 VYRDEIIPLADIITPNQFEVELLTEKEVRSEAAVWEAMEWFHQRGIKTVVISSSDLGQPG----- 196
            ||||.::|:|:||||||||.||||..::|::....:.|:..|..|..||||:||:|  |.     
 Frog   139 VYRDLVVPVANIITPNQFEAELLTGLKIRTKMEAVQVMDKLHSLGPDTVVITSSEL--PASRGAD 201

  Fly   197 VLRAFLSQQ--------NGPRLAIDIPKQGGKDLVFTGTGDLFASLFLAHS-HGSKDIANVFEKT 252
            .|....||:        :..|:::::|:   .:.||.|||||||::.||.: |...|.....|||
 Frog   202 YLVTLGSQRKVDAQGRIHTQRISLELPR---VEAVFVGTGDLFAAMLLAWTHHHPNDFKLACEKT 263

  Fly   253 IASLQAVIKRTVAS---LPNGGNGPVKAAERELKLVQSKTEIEQPQVLL 298
            ::::..:::||:.|   |...|..|. .|:.|:::|||:.:||.|::::
 Frog   264 VSAMHHILQRTICSAKALAGPGVKPT-YAQLEIRMVQSRKDIESPELVV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdxkNP_996031.1 ribokinase_pfkB_like 11..303 CDD:294126 140/309 (45%)
pdxkNP_001072713.1 ribokinase_pfkB_like 1..308 CDD:320807 139/304 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5562
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2731
Inparanoid 1 1.050 243 1.000 Inparanoid score I3230
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091630at2759
OrthoFinder 1 1.000 - - FOG0002400
OrthoInspector 1 1.000 - - oto104013
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1589
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.