DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdxk and CG34456

DIOPT Version :9

Sequence 1:NP_996031.1 Gene:Pdxk / 39066 FlyBaseID:FBgn0085484 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001097559.1 Gene:CG34456 / 5740168 FlyBaseID:FBgn0085485 Length:167 Species:Drosophila melanogaster


Alignment Length:66 Identity:16/66 - (24%)
Similarity:26/66 - (39%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGATNADIKRVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSNHTGYKTFKGPVSNEK 65
            :|||::.|.|  :.::...|..|  ..||....|.|....|          .|.:..|.|.:.:|
  Fly    11 LAGASSGDEK--IPVEQGFVPRY--TPVAESKRQDLDLPAD----------VGIEQQKRPAAGDK 61

  Fly    66 E 66
            :
  Fly    62 K 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdxkNP_996031.1 ribokinase_pfkB_like 11..303 CDD:294126 11/56 (20%)
CG34456NP_001097559.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2240
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.