powered by:
Protein Alignment Pdxk and CG34456
DIOPT Version :9
Sequence 1: | NP_996031.1 |
Gene: | Pdxk / 39066 |
FlyBaseID: | FBgn0085484 |
Length: | 304 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097559.1 |
Gene: | CG34456 / 5740168 |
FlyBaseID: | FBgn0085485 |
Length: | 167 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 26/66 - (39%) |
Gaps: | 14/66 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAGATNADIKRVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSNHTGYKTFKGPVSNEK 65
:|||::.|.| :.::...|..| ..||....|.|....| .|.:..|.|.:.:|
Fly 11 LAGASSGDEK--IPVEQGFVPRY--TPVAESKRQDLDLPAD----------VGIEQQKRPAAGDK 61
Fly 66 E 66
:
Fly 62 K 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2240 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.