DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and Pglyrp1

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:164 Identity:61/164 - (37%)
Similarity:92/164 - (56%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYN 123
            ::.||||.. .||.....||.||..::|.|||...|...|.|..:.:.:|.:.||..||.|:.||
  Rat    21 VVPRSEWKA-LPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYN 84

  Fly   124 FLVGGDGQIYVGRGWHIQGQHVNG-YGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRL 187
            ||:|.||.:|.||||.|:|.|... :..:|:.|.|:|.:.:..|..|.:.||..|:..||....|
  Rat    85 FLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFL 149

  Fly   188 QPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQ 221
            :.:|.:..||.:..|.|||.:|:|::|:|..:.:
  Rat   150 RSNYEVKGHRDVQSTLSPGDQLYEIIQSWDHYRE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 53/140 (38%)
PGRP 236..363 CDD:295442
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 53/140 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.