DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and Pglyrp2

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_006524773.1 Gene:Pglyrp2 / 57757 MGIID:1928099 Length:544 Species:Mus musculus


Alignment Length:198 Identity:66/198 - (33%)
Similarity:92/198 - (46%) Gaps:21/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RSEWLGEPPSGKYPHLKLPVSNIIIHHTATEG--CEQEDVCIYRMKTIQAFHMKSFGWVDIGYNF 124
            |..|...|..|....|:||:..:.:|||....  |.....|...|:::|.||.....|.||||:|
Mouse   365 RCRWGAAPYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQDVRKWDDIGYSF 429

  Fly   125 LVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDE-GVRLHRLQ 188
            :||.||.:|.|||||..|.|..||.:....:||:|.:....|....:...:..:.. .:|...|:
Mouse   430 VVGSDGYLYQGRGWHWVGAHTRGYNSRGFGVAFVGNYTGSLPNEAALNTVRDALPSCAIRAGLLR 494

  Fly   189 PDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQDPTSLRLLSNETVKIVTRPYWLAQPPIVPLTP 253
            |||.:..||||..|..||..||.|::.||.||:  .||                |...|.:.|:|
Mouse   495 PDYKLLGHRQL
VLTHCPGNALFNLLRTWPHFTE--VSL----------------LVPVPELSLSP 541

  Fly   254 LKL 256
            :.|
Mouse   542 MHL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 47/139 (34%)
PGRP 236..363 CDD:295442 5/21 (24%)
Pglyrp2XP_006524773.1 PGRP 360..505 CDD:128941 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.