DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and pglyrp6

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001038687.2 Gene:pglyrp6 / 571817 ZFINID:ZDB-GENE-071227-2 Length:498 Species:Danio rerio


Alignment Length:178 Identity:62/178 - (34%)
Similarity:89/178 - (50%) Gaps:23/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PNKGLHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHT--ATEGCEQEDVCIYRMKTIQAFHMKSF 115
            ||    |:.||:|......|...:|.|||..:.||||  .::.|...:.|...|:::|.:|.:|.
Zfish   328 PN----IITRSQWGAASYIGSPSYLSLPVRYLFIHHTYQPSKPCTTFEQCAAEMRSMQRYHQQSN 388

  Fly   116 GWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDE 180
            ||.||||:|:.|.||.:|.||||:..|.|..||.:|...:.|||.:.:..|.:..:..       
Zfish   389 GWSDIGYSFVAGSDGNLYEGRGWNWVGAHTYGYNSIGYGVCFIGDYTSTLPASSAMNM------- 446

  Fly   181 GVRLH---------RLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRF 219
             ||..         ||...|.:|.|||.:.||.||..|:..:|.|.|:
Zfish   447 -VRYDFTYCATNGGRLSKSYSLYGHRQAAATECPGNTLYRQIQTWERY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 51/152 (34%)
PGRP 236..363 CDD:295442
pglyrp6NP_001038687.2 PGRP 328..472 CDD:128941 52/155 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.