DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and pglyrp2

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:170 Identity:65/170 - (38%)
Similarity:87/170 - (51%) Gaps:5/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTA--TEGCEQEDVCIYRMKTIQAFHMKSFGWVDIG 121
            |:.|..|...||......|..|:|.:.|||||  ::.|.....|...|:.:|.||.|.:||.|||
Zfish   287 IIPRCIWGAAPPQVPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYDIG 351

  Fly   122 YNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAK-RLMDEGVRLH 185
            |:|:||.||.||.||||..||.|..|...:...:||||.:....|....:|..: .|:..||...
Zfish   352 YSFVVGSDGYIYEGRGWMSQGAHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNG 416

  Fly   186 RLQPDYHIYAHRQLSPTES-PGQKLFELMQNWPRF-TQDP 223
            .||.|:.|..|||:..|.| ||..|:..:..|..: .:||
Zfish   417 FLQEDFTILGHRQVVVTTSCPGNALYSEITTWMHYKDKDP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 56/142 (39%)
PGRP 236..363 CDD:295442
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 56/142 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.