DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and pglyrp1

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:213 Identity:72/213 - (33%)
Similarity:109/213 - (51%) Gaps:15/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 THPGKPINNEKRFRFELLYFCV-ILLMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPS 71
            |.||     .|.....||..|: |:|.::.:    |..:.:.:...|.    ||.:::|.|...:
 Frog    14 TEPG-----AKTDTGALLCRCLTIMLRLLAI----FATLCAVANSCPT----ILTKAQWGGRAAT 65

  Fly    72 GKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGR 136
            .: ..:..||..:||||||...|..:..||.:.|:||.:||.|..|.|:||:||||.||.:|.||
 Frog    66 CR-TAMTTPVPYVIIHHTAGAHCSSQTSCISQAKSIQNYHMNSNAWCDVGYSFLVGEDGNVYEGR 129

  Fly   137 GWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSP 201
            ||:..|.|...|.:.|:.|:.:||:.|:.|......|.|.|:..||....::..|.:..||.:..
 Frog   130 GWNSVGAHAPNYNSNSIGISVMGTYTNINPNTAAQNAVKNLISCGVTKGYIKSTYILKGHRNVGS 194

  Fly   202 TESPGQKLFELMQNWPRF 219
            ||.||...:..::.||||
 Frog   195 TECPGNTFYNTVKTWPRF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 53/141 (38%)
PGRP 236..363 CDD:295442
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 54/145 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.