DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and PGRP-LB

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster


Alignment Length:214 Identity:73/214 - (34%)
Similarity:101/214 - (47%) Gaps:15/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEG-CEQEDVCI 101
            :.||...|...:.........:|.||:|....|. ...|.:.|...:||||:.... |.....|:
  Fly    34 SCGYSQHMQQANLGDGVATARLLSRSDWGARLPK-SVEHFQGPAPYVIIHHSYMPAVCYSTPDCM 97

  Fly   102 YRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEP 166
            ..|:.:|.||....||.||||:|.:||||.||.|||:::.|.|...|...||.|..||.:....|
  Fly    98 KSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELP 162

  Fly   167 PARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQDPTSLRLLSN 231
            |.:.::|||.|:..||....:.|.|.:..|||:..||.||.:||..:.:||.||      .:...
  Fly   163 PKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFT------HINDT 221

  Fly   232 ETVKIVTRPYWLAQPPIVP 250
            |.|...|       .|:||
  Fly   222 EGVSSTT-------APVVP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 53/142 (37%)
PGRP 236..363 CDD:295442 4/15 (27%)
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 53/142 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.