DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and PGRP-SB1

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster


Alignment Length:189 Identity:61/189 - (32%)
Similarity:96/189 - (50%) Gaps:6/189 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTAT-EGCEQED 98
            :...|...:..::.|.::    |.|..||.| |...:.....:...|..:||||:.. .||...:
  Fly     7 ISFVAALVLCCLALSANA----LQIEPRSSW-GAVSARSPSRISGAVDYVIIHHSDNPNGCSTSE 66

  Fly    99 VCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVN 163
            .|...:|.||:.|.....:.||||||:|.|||::|.|||:.:||.|...|...|:.|.|||.|..
  Fly    67 QCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFER 131

  Fly   164 MEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQD 222
            ..|.|:.::.||.|::...:...|:.:|.::.|||...|..||..|:..::.||.:.|:
  Fly   132 SAPSAQMLQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQN 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 51/142 (36%)
PGRP 236..363 CDD:295442
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 51/142 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.