DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and PGRP-SC1b

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster


Alignment Length:199 Identity:68/199 - (34%)
Similarity:107/199 - (53%) Gaps:26/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VILLMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPS-----GKYPHLKLPVSNIIIHH 88
            |.||:.|.:.:.|..           :|::::.::||.|....     |.|      :|..||||
  Fly     5 VALLLAVLVCSQYMA-----------QGVYVVSKAEWGGRGAKWTVGLGNY------LSYAIIHH 52

  Fly    89 TATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISV 153
            ||...||....|...::::|.:||.|.||.|||||||:||||.:|.||||:..|.|...:...|:
  Fly    53 TAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSI 117

  Fly   154 SIAFIGTF--VNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQNW 216
            .|:|:|.:  ..:||  ..|.||::|:::.|...:|...|.:|.|||:|.||.||..::..::.|
  Fly   118 GISFLGNYNWDTLEP--NMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGW 180

  Fly   217 PRFT 220
            ..::
  Fly   181 SHWS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 55/148 (37%)
PGRP 236..363 CDD:295442
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 55/148 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.