DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and Pglyrp2

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:162 Identity:60/162 - (37%)
Similarity:85/162 - (52%) Gaps:3/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RSEWLGEPPSGKYPHLKLPVSNIIIHHTATEG--CEQEDVCIYRMKTIQAFHMKSFGWVDIGYNF 124
            |..|...|..|....|:||:..:.:|||....  |.....|...|:::|.||....||.||||:|
  Rat   357 RCRWGAAPYRGHPTPLRLPLGLLYVHHTYVPAPPCTTFQSCAADMRSMQRFHQNVRGWADIGYSF 421

  Fly   125 LVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDE-GVRLHRLQ 188
            :||.||.:|.|||||..|.|..||.:....:||:|.:....|....:...:.::.. .:|...|:
  Rat   422 VVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFVGNYTGSLPSEAALNTVRDVLPSCAIRAGLLR 486

  Fly   189 PDYHIYAHRQLSPTESPGQKLFELMQNWPRFT 220
            |||.::.||||..|:.||..||.|::.||.||
  Rat   487 PDYKLFGHRQLGKTDCPGNALFNLLRTWPHFT 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 48/139 (35%)
PGRP 236..363 CDD:295442
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 48/139 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.