DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and Pglyrp1

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:201 Identity:69/201 - (34%)
Similarity:107/201 - (53%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLYFCVILLMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPP--SGKYPHLKLPVSNIII 86
            :|:.|. ||.::|||..     .||          |:.||||...|.  |.:..|   ||..::|
Mouse     1 MLFACA-LLALLGLATS-----CSF----------IVPRSEWRALPSECSSRLGH---PVRYVVI 46

  Fly    87 HHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNG-YGA 150
            .|||...|...|.|..:.:.:|.:|....||.|:.||||:|.||.:|.||||:|:|.|... :..
Mouse    47 SHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNP 111

  Fly   151 ISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQLSPTESPGQKLFELMQN 215
            :|:.|.|:|.|::..|..|.:.||..|::.||....|:.:|.:..||.:..|.|||.:|::::|:
Mouse   112 MSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQS 176

  Fly   216 WPRFTQ 221
            |..:.:
Mouse   177 WEHYRE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 53/144 (37%)
PGRP 236..363 CDD:295442
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 53/142 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6354
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.