DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and mig-39

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_498871.3 Gene:mig-39 / 185686 WormBaseID:WBGene00018369 Length:943 Species:Caenorhabditis elegans


Alignment Length:203 Identity:39/203 - (19%)
Similarity:68/203 - (33%) Gaps:55/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAF--IGTFVNMEPPARQIEAAKRLMDEGVRLHRL 187
            |.||.|..|..:...:..:::||..:..::..|  :....|:.|     .:..|::..|:     
 Worm   508 LTGGAGNSYETQVILLAFRNINGNQSEDLTAVFEKVLQDYNISP-----SSINRVICSGL----- 562

  Fly   188 QPDYHIYAHRQLSPTESPGQ------KLFELMQNWPRFTQDPTSLRLLSNETVKIVTRPYWLAQP 246
                    :....|.|.|.|      :|....::|  ....||...|..|....:|:   :|..|
 Worm   563 --------NELAEPAELPKQMDSFSSRLANCFKSW--LETSPTVEVLKKNVYAMLVS---YLTVP 614

  Fly   247 PIVPLTPLKLPIESVRFVATNTPSCFTQAECTFRVRLLQNWHI---ESNGYKDINYNFVAAGDEN 308
            ..:.|....|                   :..|.|.|.:.:|:   ....::|| |.....|...
 Worm   615 AAIQLASQML-------------------KAKFEVPLTEPFHVIVEHLVAHRDI-YQMNMEGITL 659

  Fly   309 IYEARGWD 316
            |.| |.|:
 Worm   660 ISE-REWN 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 12/75 (16%)
PGRP 236..363 CDD:295442 17/84 (20%)
mig-39NP_498871.3 Dimer_Tnp_hAT <866..>902 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.