Sequence 1: | NP_648299.3 | Gene: | PGRP-LF / 39064 | FlyBaseID: | FBgn0035977 | Length: | 369 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498871.3 | Gene: | mig-39 / 185686 | WormBaseID: | WBGene00018369 | Length: | 943 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 39/203 - (19%) |
---|---|---|---|
Similarity: | 68/203 - (33%) | Gaps: | 55/203 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 LVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAF--IGTFVNMEPPARQIEAAKRLMDEGVRLHRL 187
Fly 188 QPDYHIYAHRQLSPTESPGQ------KLFELMQNWPRFTQDPTSLRLLSNETVKIVTRPYWLAQP 246
Fly 247 PIVPLTPLKLPIESVRFVATNTPSCFTQAECTFRVRLLQNWHI---ESNGYKDINYNFVAAGDEN 308
Fly 309 IYEARGWD 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PGRP-LF | NP_648299.3 | PGRP | 57..199 | CDD:128941 | 12/75 (16%) |
PGRP | 236..363 | CDD:295442 | 17/84 (20%) | ||
mig-39 | NP_498871.3 | Dimer_Tnp_hAT | <866..>902 | CDD:283379 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |