DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LF and PGLYRP2

DIOPT Version :9

Sequence 1:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:205 Identity:72/205 - (35%)
Similarity:101/205 - (49%) Gaps:30/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RSEWLGEPPSGKYPHLKLPVSNIIIHHTATEG--CEQEDVCIYRMKTIQAFHMKSFGWVDIGYNF 124
            |..|...|..|:...|:||:..:.:|||....  |.....|...|:::|.:|..:.||.||||:|
Human   385 RCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSF 449

  Fly   125 LVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDE-----GVRL 184
            :||.||.:|.|||||..|.|..|:.:....:|.:|.:....|    .|||.|.:.:     .||.
Human   450 VVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALP----TEAALRTVRDTLPSCAVRA 510

  Fly   185 HRLQPDYHIYAHRQLSPTESPGQKLFELMQNWPRFTQDPTSLRLLSNETVKIVTRPYWLAQPPIV 249
            ..|:|||.:..||||..|:.||..||:|::.||.||  ..|||.|           ::.|:.|.|
Human   511 GLLRPDYALLGHRQL
VRTDCPGDALFDLLRTWPHFT--AVSLRSL-----------HYTARRPSV 562

  Fly   250 ------PLTP 253
                  ||.|
Human   563 YTSSTRPLPP 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 50/143 (35%)
PGRP 236..363 CDD:295442 6/24 (25%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 50/143 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.