DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:168 Identity:54/168 - (32%)
Similarity:78/168 - (46%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420
            |.|.:|.|.|.:.. ..|:.||..|:...|....||:...|..:.|.:|.|.::....||:||||
  Rat    22 VPRSEWKALPSECS-KGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMKQLGWCDVAYNF 85

  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485
            |||.||:||.||||...|.|...| ::..|:...::|.:....|:.:.|.....||:.||..|.:
  Rat    86 LIGEDGHVYEGRGWTIKGDHTGPI-WNPMSIGITFMGDYSHRVPAKRALRAALNLLKCGVSEGFL 149

  Fly   486 APSYRF----TASSKLMPSVTDFKADALYASFANWTHW 519
            ..:|..    ...|.|.|      .|.||....:|.|:
  Rat   150 RSNYEVKGHRDVQSTLSP------GDQLYEIIQSWDHY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 45/133 (34%)
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 46/140 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.