DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGLYRP4

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_065126.2 Gene:PGLYRP4 / 57115 HGNCID:30015 Length:373 Species:Homo sapiens


Alignment Length:164 Identity:51/164 - (31%)
Similarity:82/164 - (50%) Gaps:6/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420
            |.|..|.|:  :...|.:.||....|.:.|....|:....|.|.||.:|::.|:..:.|||.|||
Human   214 VPRSVWGAR--ETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNF 276

  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485
            |:|.||.:|.|.|||..|:  :...||..:|...::|:|..|.|:|..|...:.|::..:..|.:
Human   277 LVGQDGAIYEGVGWNVQGS--STPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYL 339

  Fly   486 APSYRFTASSKLMPSVTDFKADALYASFANWTHW 519
            .|:|.....|.:..:::  ...|||...:.|.|:
Human   340 TPNYLLVGHSDVARTLS--PGQALYNIISTWPHF 371

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 44/133 (33%)
PGLYRP4NP_065126.2 PGRP 53..194 CDD:128941
PGRP 211..351 CDD:128941 46/140 (33%)
Interaction with murein 293..302 2/10 (20%)