DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and pglyrp2

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:202 Identity:55/202 - (27%)
Similarity:93/202 - (46%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 IPINSTIDLDN-IGGGL---ILRFVE------RQQWLAQPPQKEIPDLELPVGLV----IALPTN 386
            :|.....:|:: |..|:   :||:::      |..|.|.|||..:..|..|:..:    .|:|  
Zfish   258 LPSQGDAELESLIAKGIKEFVLRYMDCPSIIPRCIWGAAPPQVPLELLSPPMSFLYIHHTAIP-- 320

  Fly   387 SENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAH---MNNINYDS 448
            |:.|.....|...:|.:|.:..:.....||.|:|::|.||.:|.||||...|||   .||:.|  
Zfish   321 SKPCLNLQTCSQNMRAMQRFHQKDWGWYDIGYSFVVGSDGYIYEGRGWMSQGAHTKGRNNVGY-- 383

  Fly   449 QSLSFAYIGSFKTIQPSAKQLSVTR-LLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALYAS 512
               ..|:||.:....||...:.:.| .|::.||..|.:...:......:::.: |....:|||:.
Zfish   384 ---GVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNGFLQEDFTILGHRQVVVT-TSCPGNALYSE 444

  Fly   513 FANWTHW 519
            ...|.|:
Zfish   445 ITTWMHY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 43/147 (29%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 43/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.