DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and pglyrp5

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001037786.1 Gene:pglyrp5 / 553387 ZFINID:ZDB-GENE-050419-71 Length:238 Species:Danio rerio


Alignment Length:170 Identity:53/170 - (31%)
Similarity:77/170 - (45%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 TLNQSKIRDDDDYRQNIPINSTIDLDNIGGGLILRFVERQQWLAQPPQKEIPDLELPVGLVIALP 384
            |.|:..:.|.|.:...:.||:..             |.|:.|.|..| :|:..:|.|...||...
Zfish    48 TGNEKFVADMDGHTNTVDINADT-------------VSRRGWDAVQP-REMTQMESPAHTVIVHH 98

  Fly   385 TNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQ 449
            |....|:.....|..:..:|...::.....||.|||||.|||.||.||||..:|||....|:  .
Zfish    99 TALRFCAHPRESVTELAHIQRMHMQERGFDDIGYNFLISGDGTVYEGRGWGIVGAHAKEHNF--Y 161

  Fly   450 SLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSY 489
            |:..|::|:.....||:..||....||..||..|.:.|::
Zfish   162 SVGIAFMGNLNADLPSSASLSALLRLLHIGVLHGHVRPNF 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 47/134 (35%)
pglyrp5NP_001037786.1 PGRP 68..209 CDD:128941 47/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.