DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and pglyrp1

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:141 Identity:47/141 - (33%)
Similarity:74/141 - (52%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 PVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAH 440
            ||..||...|...:||:|..|:.:.:.:|.|.:.|:..||:.|:||:|.|||||.|||||.:|||
 Frog    73 PVPYVIIHHTAGAHCSSQTSCISQAKSIQNYHMNSNAWCDVGYSFLVGEDGNVYEGRGWNSVGAH 137

  Fly   441 MNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTDFK 505
            ..  ||:|.|:..:.:|::..|.|:....:..:.|:..||..|.|..:|.......:  ..|:..
 Frog   138 AP--NYNSNSIGISVMGTYTNINPNTAAQNAVKNLISCGVTKGYIKSTYILKGHRNV--GSTECP 198

  Fly   506 ADALYASFANW 516
            .:..|.:...|
 Frog   199 GNTFYNTVKTW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 43/113 (38%)
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 44/120 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.