DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and Pglyrp3

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001178890.1 Gene:Pglyrp3 / 499658 RGDID:1593164 Length:339 Species:Rattus norvegicus


Alignment Length:164 Identity:51/164 - (31%)
Similarity:83/164 - (50%) Gaps:6/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420
            :.|..|.|:  :.....:.||...||.:.|..|:|:..|.|::|||..|::.::....|||||:|
  Rat   180 IPRTAWEAR--ETHCSQMNLPAKFVIIIHTAGESCNESADCLIRVRDTQSFHMDKQDFCDIAYHF 242

  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485
            |:|.||.||.|.||...|:|  ...|:..:|..|::|:|....|:...|...:.|::..|.:|.:
  Rat   243 LVGQDGVVYEGVGWTIEGSH--TYGYNDIALGIAFMGNFVEKPPNEASLEAAQSLIQCAVAMGYL 305

  Fly   486 APSYRFTASSKLMPSVTDFKADALYASFANWTHW 519
            |.:|.....|.:...::  ...|||.....|.|:
  Rat   306 ASNYLLMGHSDVSNILS--PGQALYNIIKTWPHF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 44/133 (33%)
Pglyrp3NP_001178890.1 PGRP 19..152 CDD:128941
PGRP 177..317 CDD:128941 46/140 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.