DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGRP-LB

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster


Alignment Length:205 Identity:57/205 - (27%)
Similarity:95/205 - (46%) Gaps:19/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 LNQSKIRDDDDYRQNIPINSTIDLDNIGGGL-ILRFVERQQWLAQPPQKEIPDLELPVGLVIA-- 382
            |.|.::.....|.|:      :...|:|.|: ..|.:.|..|.|:.| |.:...:.|...||.  
  Fly    26 LEQQQLATSCGYSQH------MQQANLGDGVATARLLSRSDWGARLP-KSVEHFQGPAPYVIIHH 83

  Fly   383 --LPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNIN 445
              :|.   .|.:...|:..:|.:|.:........||.|:|.|||||.:|.|||:|.:|||..  .
  Fly    84 SYMPA---VCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAP--K 143

  Fly   446 YDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALY 510
            |:.:|:....||.::|..|..:.|...:.|:..||..|.|.|:|:.....::..  |:.....|:
  Fly   144 YNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRD--TECPGGRLF 206

  Fly   511 ASFANWTHWS 520
            |..::|.|::
  Fly   207 AEISSWPHFT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 43/137 (31%)
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.