DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGRP-SB1

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster


Alignment Length:146 Identity:47/146 - (32%)
Similarity:70/146 - (47%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 LVIALPTNSENCSTQAICVLRVRLLQTYDIESSQK-----CDIAYNFLIGGDGNVYVGRGWNKMG 438
            ::|....|...|||...|...::     :|:|..|     .||.|||::.|||.||.|||:...|
  Fly    51 VIIHHSDNPNGCSTSEQCKRMIK-----NIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQG 110

  Fly   439 AHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTD 503
            :|  :.||:.:|:...:||:|:...|||:.|...:.|:|...:.|.:..:|  |.........|.
  Fly   111 SH--SPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLKDNY--TLFGHRQTKATS 171

  Fly   504 FKADALYASFANWTHW 519
            ...||||.....|.||
  Fly   172 CPGDALYNEIKTWPHW 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 37/115 (32%)
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_126407
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.