DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGRP-LF

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster


Alignment Length:168 Identity:61/168 - (36%)
Similarity:101/168 - (60%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LRFVERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIA 417
            |..::|.:||.:||..:.|.|:|||..:|...|.:|.|..:.:|:.|::.:|.:.::|....||.
  Fly    57 LHILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIG 121

  Fly   418 YNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKL 482
            ||||:||||.:||||||:..|.|:|  .|.:.|:|.|:||:|..::|.|:|:...:.|::.||:|
  Fly   122 YNFLVGGDGQIYVGRGWHIQGQHVN--GYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRL 184

  Fly   483 GKIAPSYRFTASSKLMPSVTDFKADALYASFANWTHWS 520
            .::.|.|...|..:|.|  |:.....|:....||..::
  Fly   185 HRLQPDYHIYAHRQLSP--TESPGQKLFELMQNWPRFT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 52/133 (39%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 55/143 (38%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.