DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and Pglyrp4

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001159440.1 Gene:Pglyrp4 / 384997 MGIID:2686324 Length:375 Species:Mus musculus


Alignment Length:164 Identity:56/164 - (34%)
Similarity:76/164 - (46%) Gaps:6/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420
            |.|..|.|:  ......:.||....|.|.|....||....|.|.||.||::.:.....|||.|||
Mouse   216 VPRSVWGAR--DSHCSRMTLPAKYAIILHTAGRTCSQPDECRLLVRDLQSFFMNRLNACDIGYNF 278

  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485
            |:|.||.||.|.|||..|:..:  :|:..|||..::|:|....|:|..|...:.|:...|..|.:
Mouse   279 LVGQDGGVYEGVGWNNQGSKTD--SYNDISLSITFMGTFTGSPPNAAALEAAQDLIRCAVVKGYL 341

  Fly   486 APSYRFTASSKLMPSVTDFKADALYASFANWTHW 519
            .|:|.....|.:  |.|.....|||.....|.|:
Mouse   342 TPNYLLMGHSDV--SNTLSPGQALYNIIKTWPHF 373

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 47/133 (35%)
Pglyrp4NP_001159440.1 PGRP 58..192 CDD:128941
PGRP 213..353 CDD:128941 49/140 (35%)
Interaction with murein. /evidence=ECO:0000250 295..304 2/10 (20%)