DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGRP-LD

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:373 Identity:86/373 - (23%)
Similarity:132/373 - (35%) Gaps:109/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 NPLEAGIVAK------QILNGNLAVATPTSPAGGATQGIGSIALTNSTDVTFGDKHFYEGPVTIQ 231
            |.|.|.|:||      .:....:|..:| |||..:....||  |.:|.|:               
  Fly    33 NHLVAFILAKLHNLLFALYFATIARRSP-SPAAVSQSSYGS--LGSSQDI--------------- 79

  Fly   232 QFLIDNRDKWKPGEGPAGGQDNP---AFNGGPSTNGSAPGSKHEDPAQTPPICPFLP----NTVG 289
            ...:|.       ||.| .:..|   |......|:.|...|.... :.||..|...|    :...
  Fly    80 HIRVDK-------EGVA-SESTPLLAAAQRSIKTSSSLTASVSAS-STTPSNCRRNPTLHEDCFN 135

  Fly   290 RKAVTVTVVFVTLTFLLGIVL--ATTTNLFGKTLNQSKIRDDDDYRQNIPINSTIDLDNIGGGLI 352
            .::|.:.|:..:...|...:|  .|.|..||             ||.:|          :|.|: 
  Fly   136 WRSVGLLVMCASALALAAYLLWRQTQTPDFG-------------YRLSI----------VGHGI- 176

  Fly   353 LRFVERQQWLAQPPQKEIPDLELP----------VGLVIALPTNSENCSTQAICVLRVRLLQTYD 407
                    |         .|:||.          ||.||...|.|..|......||       :.
  Fly   177 --------W---------SDMELQGRGTLFDPIGVGTVIFTHTGSNECHDDCPDVL-------HK 217

  Fly   408 IESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVT 472
            :|.|...::.||||:.||..|:..:||:....:..::| ...||..|::|:|....|...||...
  Fly   218 LERSHVGELPYNFLVAGDCQVFEAQGWHYRSQYPRDLN-GIDSLVMAFVGNFSGRPPIDCQLMAA 281

  Fly   473 RLLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALYASFANWTHWS 520
            :.|:...:|...:.|.|:..    ::.|.|    |||.....:|.|::
  Fly   282 QALILESLKRRILQPIYQLF----VLGSYT----DALQRELRHWPHYA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 36/143 (25%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.