DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGRP-SC2

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster


Alignment Length:135 Identity:47/135 - (34%)
Similarity:77/135 - (57%) Gaps:4/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 TNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQ 449
            |....|||:|.|:.:::.:|.|.::|....||.||||||||||||.|||||.||||..  |::|:
  Fly    52 TAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHAT--NWNSK 114

  Fly   450 SLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALYASFA 514
            |:..:::|::.|...::.|::..:.||...|..|:|...|......::  ..|:.....::....
  Fly   115 SIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYILYGHRQV--GSTECPGTNIWNEIR 177

  Fly   515 NWTHW 519
            .|::|
  Fly   178 TWSNW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 43/104 (41%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.