DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGRP-LE

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001245695.1 Gene:PGRP-LE / 32534 FlyBaseID:FBgn0030695 Length:345 Species:Drosophila melanogaster


Alignment Length:423 Identity:105/423 - (24%)
Similarity:157/423 - (37%) Gaps:129/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DDNAIDSSSIDSDSEAE------AEDYTVQKLGHQVTYPPN---SSHLRDLNQGLTVISRHVAPG 165
            :.:.:||...|...|.|      :|:.:...||.|:....:   |..:|||...:..|       
  Fly    31 ESSVVDSLDYDYTEEEEDADQNTSEEISTMTLGTQIATKKHSIISDTIRDLMNSINSI------- 88

  Fly   166 EAAVPPPNPLEAGIVAKQILNGNLAVATPTSPAGGATQGIGSIALTNSTDVTFGDKHFYEGPV-T 229
                                                 |.:|::.::|||:|..|:.....|.: .
  Fly    89 -------------------------------------QTLGNVNISNSTNVHIGNVTNINGNIQI 116

  Fly   230 IQQFLIDNRDKWKPGEGPAGGQDNPAFNGGPSTNGSAPGSKHEDPAQTPPICPFLPNTVGRKAVT 294
            |...|..||...:....|   :||     .|.|     .:..||..|..                
  Fly   117 IADGLTQNRRDRRHVSPP---RDN-----APKT-----PTHFEDDYQDE---------------- 152

  Fly   295 VTVVFVTLTFLLGIVLATTTNLFGKTLNQSKIRDDDDYRQ---NIPINSTIDLDNIGGGLILRFV 356
                                       ::.::|.|...|:   .||..            :...:
  Fly   153 ---------------------------SEERVRSDVFIRRQKFKIPKE------------LSAII 178

  Fly   357 ERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNFL 421
            .|..||||.|..|...|:|||..|:.|.|.:|:...:||.|..:|.:|.:.|||....|||||||
  Fly   179 PRSSWLAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGWNDIAYNFL 243

  Fly   422 IGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKIA 486
            :|.|||:|.||||..:|||  .:.|:..||..::||.|....|:|..|::.|.||.|||:.|.|:
  Fly   244 VGCDGNIYEGRGWKTVGAH--TLGYNRISLGISFIGCFMKELPTADALNMCRNLLARGVEDGHIS 306

  Fly   487 PSYRFTASSKLMPSVTDFKADALYASFANWTHW 519
            ..||.....:.  :.|:.....||.....|.|:
  Fly   307 TDYRLICHCQC--NSTESPGRRLYEEIQTWPHF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 59/133 (44%)
PGRP-LENP_001245695.1 PGRP 175..317 CDD:128941 61/143 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.