DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and Pglyrp4

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038958226.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:384 Species:Rattus norvegicus


Alignment Length:164 Identity:54/164 - (32%)
Similarity:78/164 - (47%) Gaps:6/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420
            |.|..|.|:  :.....:.||....|.|.|....||....|.|.::.||::.::....|||.|||
  Rat   225 VPRSAWGAR--ESHCFKMTLPAKYAIILHTAGRTCSQPDECRLLIQDLQSFFMDRLNACDIGYNF 287

  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485
            |:|.||.||.|.|||..|:..:  .|:..:||.|::|.|....|:|..|...:.|::..|..|.:
  Rat   288 LVGQDGGVYEGVGWNNQGSKTD--GYNDIALSIAFMGIFTGSSPNAAALQAAQDLIQCAVVKGYL 350

  Fly   486 APSYRFTASSKLMPSVTDFKADALYASFANWTHW 519
            .|:|.....|.:  |.|.....|||.....|.|:
  Rat   351 TPNYLLMGHSDV--SNTLSPGQALYNIIKTWPHF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 45/133 (34%)
Pglyrp4XP_038958226.1 PGRP 67..201 CDD:128941
PGRP 222..362 CDD:128941 47/140 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_126407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.