DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:515 Identity:106/515 - (20%)
Similarity:170/515 - (33%) Gaps:176/515 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AEDYTVQKLGHQ----------VTYPPNSSHLRDLNQGLTVISRH-----------VAPGEAAV- 169
            |::|:.....||          .|.|...|...:|...::.:::|           :||..:.| 
  Rat    59 AKNYSSHNSLHQHLLLKAPSQNTTEPDTHSLSPELQALISEVAQHDVRDGQEYGVVLAPDGSTVA 123

  Fly   170 --PPPNPLEAGIVAKQILN-----------GNL------AVATPTSPAGGATQGIGSIALTNSTD 215
              |....||||:..:.:.|           |.:      |....:||..|||       |.|...
  Rat   124 VKPLLVGLEAGLQGRSVANLSSDCLDTCDTGAIWPGLKDAFTNVSSPDAGAT-------LPNDKA 181

  Fly   216 VTFGDKHFYEGPVTIQQFL------------IDNRDKWKPGEGPAGGQDNPAFNGGPSTNGSAPG 268
            .|         |.|:.:.|            :.....|.|                       ||
  Rat   182 KT---------PTTVDRLLAVTLAGDLGLTFLHRSQTWSP-----------------------PG 214

  Fly   269 SKHE---DPAQTPPICPFLPNTVGRKAVTVTVVFVTLTFLLGIVLATTTNLFGKTLNQ------- 323
            ...|   |....|.:...|.:...|         :|:.||.|   |....|.|..|::       
  Rat   215 LGIEGCWDQLSAPRVFTLLDHKASR---------LTMAFLNG---ALDGALLGAHLSRIPKPHPP 267

  Fly   324 ----------SKIRDDDDYRQNIPINSTIDL-------DNIGGGLIL------------------ 353
                      :.:..|..:|.|....:.:.|       ..:...|:|                  
  Rat   268 LSRLLREYYGAGVDGDPAFRSNFRRQNGVALTSAPTLAQQVWEALVLLQKLEPGHPRLQNMSQKQ 332

  Fly   354 ----------RFVE----------RQQWLAQPPQKEIPDLELPVGLVIALPT--NSENCSTQAIC 396
                      .|.|          |.:|.|.|.:.....|.||:||:....|  .:..|:|...|
  Rat   333 LAQVATFATKEFTEAFLGCPAIHPRCRWGAAPYRGHPTPLRLPLGLLYVHHTYVPAPPCTTFQSC 397

  Fly   397 VLRVRLLQTYDIESSQKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKT 461
            ...:|.:|.:........||.|:|::|.||.||.||||:.:|||  .:.|:|:....|::|::..
  Rat   398 AADMRSMQRFHQNVRGWADIGYSFVVGSDGYVYQGRGWHWVGAH--TLGYNSRGFGVAFVGNYTG 460

  Fly   462 IQPSAKQLSVTR-LLLERGVKLGKIAPSYRFTASSKLMPSVTDFKADALYASFANWTHWS 520
            ..||...|:..| :|....::.|.:.|.|:.....:|  ..||...:||:.....|.|::
  Rat   461 SLPSEAALNTVRDVLPSCAIRAGLLRPDYKLFGHRQL--GKTDCPGNALFNLLRTWPHFT 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 43/146 (29%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 43/146 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.