DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:168 Identity:56/168 - (33%)
Similarity:77/168 - (45%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESSQKCDIAYNF 420
            |.|.:|.|.|.:.. ..|..||..|:...|....|::...|..:.|.:|.|.......||:||||
Mouse    21 VPRSEWRALPSECS-SRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNF 84

  Fly   421 LIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTRLLLERGVKLGKI 485
            |||.||:||.|||||..|.|...| ::..|:...::|:|....|:.:.|.....|||.||..|.:
Mouse    85 LIGEDGHVYEGRGWNIKGDHTGPI-WNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFL 148

  Fly   486 APSYRF----TASSKLMPSVTDFKADALYASFANWTHW 519
            ..:|..    ...|.|.|      .|.||....:|.|:
Mouse   149 RSNYEVKGHRDVQSTLSP------GDQLYQVIQSWEHY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 47/133 (35%)
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 48/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.