DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and PGLYRP2

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:492 Identity:108/492 - (21%)
Similarity:169/492 - (34%) Gaps:162/492 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GLT-VISRH-----------VAPGEAAV---PPPNPLEAGIVAKQILNGNL-AVATP-------- 194
            ||| .::||           :||..:.|   |....||||:..::::|..| ::|.|        
Human    92 GLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFP 156

  Fly   195 ----TSPAGGATQGIGSIALTNSTDVTFGDKHFYEGPVTIQQFLIDNRDKWKPGEGPAGGQDNPA 255
                .:|...||...|  ....|.|||..|                           .|.....|
Human   157 DVVAIAPDVRATSSPG--LRDGSPDVTTAD---------------------------IGANTPDA 192

  Fly   256 FNGGPSTNGSAPGSKHEDPAQTPPI---------------CPFL--------------------- 284
            ..|.|....|.|.:|    |::||.               ..||                     
Human   193 TKGCPDVQASLPDAK----AKSPPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLS 253

  Fly   285 -PNT---VGRKAVTVTVVFVTLTF---LLGIVLATTTN---LFGKTLNQ---SKIRDDDDYRQNI 336
             |.|   :..||..:|:.|:....   :||..|:.|..   .....|:|   :.:..|..:|.|.
Human   254 APRTFTLLDPKASLLTMAFLNGALDGVILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNF 318

  Fly   337 P-------INSTIDLDNIGGGLIL----------------------------RFVE--------- 357
            .       .:::|....:.|.|:|                            .|.|         
Human   319 RRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIH 383

  Fly   358 -RQQWLAQPPQKEIPDLELPVGLVIALPT--NSENCSTQAICVLRVRLLQTYDIESSQKCDIAYN 419
             |.:|.|.|.:.....|:||:|.:....|  .:..|:....|...:|.:|.|..::....||.|:
Human   384 PRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYS 448

  Fly   420 FLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTR-LLLERGVKLG 483
            |::|.||.||.||||:.:|||  .:.::|:....|.:|::....|:...|...| .|....|:.|
Human   449 FVVGSDGYVYEGRGWHWVGAH--TLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAG 511

  Fly   484 KIAPSYRFTASSKLMPSVTDFKADALYASFANWTHWS 520
            .:.|.|......:|:.  ||...|||:.....|.|::
Human   512 LLRPDYALLGHRQLVR--TDCPGDALFDLLRTWPHFT 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 41/146 (28%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.