DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LC and pglyrp2

DIOPT Version :9

Sequence 1:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:167 Identity:49/167 - (29%)
Similarity:83/167 - (49%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 VERQQWLAQPPQKEIPDLELPVGLVIALPT--NSENCSTQAICVLRVRLLQTYDIESSQKCDIAY 418
            :.|..|.|:..:.:...|.||:..|....|  .|:.|::.:.|...:|.:|.:..:.....||.|
 Frog   332 IPRCMWGAKRYKGKPIFLGLPLSRVFIHHTYEPSQPCTSFSQCAANMRSMQRFHQQDRGWDDIGY 396

  Fly   419 NFLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFKTIQPSAKQLSVTR-LLLERGVKL 482
            :|::|.:|.:|.|||||:.|||..  .|:|.....::||.:.:|.|....|::.: ..|...|:|
 Frog   397 SFVVGSNGYLYEGRGWNRAGAHTR--GYNSVGYGVSFIGDYTSIVPKDSILALVKDRFLRCAVRL 459

  Fly   483 GKIAPSYRFTASSKLMPSVTDFKADALYASFANWTHW 519
            |.|.|:|......:::.  |....||||....:|.|:
 Frog   460 GYITPNYIIQGHRQVVS--TSCPGDALYKEIQSWDHF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 41/136 (30%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 42/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.