DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and pglyrp6

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001038687.2 Gene:pglyrp6 / 571817 ZFINID:ZDB-GENE-071227-2 Length:498 Species:Danio rerio


Alignment Length:173 Identity:51/173 - (29%)
Similarity:81/173 - (46%) Gaps:12/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PNLGNGHLVVDREQWGASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAI 239
            ||      ::.|.||||: :..|....|..|:.|:.|.|....|.||....:|:.:||::|....
Zfish   328 PN------IITRSQWGAA-SYIGSPSYLSLPVRYLFIHHTYQPSKPCTTFEQCAAEMRSMQRYHQ 385

  Fly   240 AEKGLPDIQSNFYVSEEGNIYVGRGWDW--ANTYANQTL--AITFMGDYGRFKPGPKQLEGVQFL 300
            ...|..||..:|....:||:|.||||:|  |:||...::  .:.|:|||....|....:..|::.
Zfish   386 QSNGWSDIGYSFVAGSDGNLYEGRGWNWVGAHTYGYNSIGYGVCFIGDYTSTLPASSAMNMVRYD 450

  Fly   301 LAHAVAN-RNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342
            ..:...| ..:...|.|....|...|..||..:|::|:.|..:
Zfish   451 FTYCATNGGRLSKSYSLYGHRQAAATECPGNTLYRQIQTWERY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 42/145 (29%)
pglyrp6NP_001038687.2 PGRP 328..472 CDD:128941 44/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.