DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and pglyrp5

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001037786.1 Gene:pglyrp5 / 553387 ZFINID:ZDB-GENE-050419-71 Length:238 Species:Danio rerio


Alignment Length:222 Identity:54/222 - (24%)
Similarity:90/222 - (40%) Gaps:33/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LVLATGLIVL-----YVELNRPKPELPS--NKAI------YFGNNYDHQTFPNLGNGHL------ 182
            :.|.||...|     |.|::...|.|.|  ||.:      :.||    :.|....:||.      
Zfish     7 IFLYTGAEFLHETGKYAEVHVCCPSLSSRANKPVSLVMLEHTGN----EKFVADMDGHTNTVDIN 67

  Fly   183 --VVDREQWGASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAEKGLP 245
              .|.|..|.|.:...  ...::.|...|::.|..::.  |.:..:...::..||...:.|:|..
Zfish    68 ADTVSRRGWDAVQPRE--MTQMESPAHTVIVHHTALRF--CAHPRESVTELAHIQRMHMQERGFD 128

  Fly   246 DIQSNFYVSEEGNIYVGRGWDWANTYANQ----TLAITFMGDYGRFKPGPKQLEGVQFLLAHAVA 306
            ||..||.:|.:|.:|.||||.....:|.:    ::.|.|||:.....|....|..:..||...|.
Zfish   129 DIGYNFLISGDGTVYEGRGWGIVGAHAKEHNFYSVGIAFMGNLNADLPSSASLSALLRLLHIGVL 193

  Fly   307 NRNIDVDYKLVAQNQTKVTRSPGAYVY 333
            :.::..::.|:.......|..||..:|
Zfish   194 HGHVRPNFVLLGHKDVAKTACPGENLY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 35/152 (23%)
pglyrp5NP_001037786.1 PGRP 68..209 CDD:128941 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.