DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and pglyrp1

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:235 Identity:55/235 - (23%)
Similarity:91/235 - (38%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RSRDKSPSRRVTRNTIL--LITLILLVLATGLIVLYVELNRPKPELPSNKAIYFGNNYDHQTFPN 176
            |.||..|..:.....:|  .:|::|.:||     ::..|.......|:                 
 Frog    10 RLRDTEPGAKTDTGALLCRCLTIMLRLLA-----IFATLCAVANSCPT----------------- 52

  Fly   177 LGNGHLVVDREQWGASKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAE 241
                  ::.:.|||.  .:......:..|:|||:|.|  .....|.:...|..:.::||:..:..
 Frog    53 ------ILTKAQWGG--RAATCRTAMTTPVPYVIIHH--TAGAHCSSQTSCISQAKSIQNYHMNS 107

  Fly   242 KGLPDIQSNFYVSEEGNIYVGRGWD----WANTYANQTLAITFMGDYGRFKPGPKQLEGVQFLLA 302
            ....|:..:|.|.|:||:|.||||:    .|..|.:.::.|:.||.|....|.......|:.|::
 Frog   108 NAWCDVGYSFLVGEDGNVYEGRGWNSVGAHAPNYNSNSIGISVMGTYTNINPNTAAQNAVKNLIS 172

  Fly   303 HAVANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342
            ..|....|...|.|........|..||...|..::.||.|
 Frog   173 CGVTKGYIKSTYILKGHRNVGSTECPGNTFYNTVKTWPRF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 37/144 (26%)
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.