DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and PGRP-LF

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster


Alignment Length:220 Identity:60/220 - (27%)
Similarity:99/220 - (45%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LITLILLVLATGLIVLYVELNRPKPELPSNKAIYFGNNYDHQTFPNLGNGHLVVDREQW----GA 191
            :|.|:::.||.|..:..:..:...|    ||.::                  ::||.:|    .:
  Fly    29 VILLMVVGLAAGYFMWMMSFSTHSP----NKGLH------------------ILDRSEWLGEPPS 71

  Fly   192 SKNSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAEKGLPDIQSNFYVSEE 256
            .|..|     ||.|:..::|.|...:.  |:....|..:|:|||...:...|..||..||.|..:
  Fly    72 GKYPH-----LKLPVSNIIIHHTATEG--CEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGD 129

  Fly   257 GNIYVGRGW----DWANTYANQTLAITFMGDYGRFKPGPKQLEGVQFLLAHAVANRNIDVDYKLV 317
            |.|||||||    ...|.|...:::|.|:|.:...:|..:|:|..:.|:...|....:..||.:.
  Fly   130 GQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIY 194

  Fly   318 AQNQTKVTRSPGAYVYQEIRNWPHF 342
            |..|...|.|||..:::.::|||.|
  Fly   195 AHRQLSPTESPGQKLFELMQNWPRF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 43/148 (29%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 43/166 (26%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.