DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and PGRP-SA

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster


Alignment Length:218 Identity:66/218 - (30%)
Similarity:100/218 - (45%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ILLITLILLVLATGLIVLYVELNRPKPELPSNKAIYFGNNYDHQTFPNLGNGHLVVDREQWGASK 193
            |:.|.|:||:||      :|...:.:...|:|             .|.      :..:.||| .|
  Fly    11 IMAIGLVLLLLA------FVSAGKSRQRSPAN-------------CPT------IKLKRQWG-GK 49

  Fly   194 NSHGLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAEKGLPDIQSNFYVSEEGN 258
            .|.||...: |||.||:|.|  ..:..|..:.||:..::.:|.....|....||..||.:..:|.
  Fly    50 PSLGLHYQV-RPIRYVVIHH--TVTGECSGLLKCAEILQNMQAYHQNELDFNDISYNFLIGNDGI 111

  Fly   259 IYVGRGWD--WANTYANQTL--AITFMGDYGRFKPGPKQLEGVQFLLAHAVANRNIDVDYKLVAQ 319
            :|.|.||.  .|:||....:  .|.|:|::....|....|:..:.|||..|....:..||.|:|.
  Fly   112 VYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLPSDAALQAAKDLLACGVQQGELSEDYALIAG 176

  Fly   320 NQTKVTRSPGAYVYQEIRNWPHF 342
            :|...|:|||..:|.||:.|||:
  Fly   177 SQVISTQSPGLTLYNEIQEWPHW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 44/144 (31%)
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.