DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and Pglyrp4

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_038958226.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:384 Species:Rattus norvegicus


Alignment Length:166 Identity:50/166 - (30%)
Similarity:79/166 - (47%) Gaps:13/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 VVDREQWGASKNSH--GLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIAEKGLP 245
            :|.|..||| :.||  .:|:|.|    |.:|.|...::  |....:|.:.::.:|...:......
  Rat   224 IVPRSAWGA-RESHCFKMTLPAK----YAIILHTAGRT--CSQPDECRLLIQDLQSFFMDRLNAC 281

  Fly   246 DIQSNFYVSEEGNIYVGRGWD----WANTYANQTLAITFMGDYGRFKPGPKQLEGVQFLLAHAVA 306
            ||..||.|.::|.:|.|.||:    ..:.|.:..|:|.|||.:....|....|:..|.|:..||.
  Rat   282 DIGYNFLVGQDGGVYEGVGWNNQGSKTDGYNDIALSIAFMGIFTGSSPNAAALQAAQDLIQCAVV 346

  Fly   307 NRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342
            ...:..:|.|:..:....|.|||..:|..|:.||||
  Rat   347 KGYLTPNYLLMGHSDVSNTLSPGQALYNIIKTWPHF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 40/144 (28%)
Pglyrp4XP_038958226.1 PGRP 67..201 CDD:128941
PGRP 222..362 CDD:128941 40/144 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.