DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LA and Pglyrp3

DIOPT Version :9

Sequence 1:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_006501534.1 Gene:Pglyrp3 / 242100 MGIID:2685266 Length:359 Species:Mus musculus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:82/174 - (47%) Gaps:19/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PNLGNGHLVVDREQWGASKNSH--GLTIPLKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDS 237
            ||      :..|..|.| :.:|  .:.:|.|    :|:|.|...:|  |:....|.:::|..|..
Mouse   197 PN------ITPRSAWEA-RETHCPQMNLPAK----FVIIIHTAGKS--CNESADCLVRVRDTQSF 248

  Fly   238 AIAEKGLPDIQSNFYVSEEGNIYVGRGW--DWANTYANQTLA--ITFMGDYGRFKPGPKQLEGVQ 298
            .|..:...||..:|.|.::|.:|.|.||  :.::||....:|  |.|||::....|....|:..|
Mouse   249 HIDNQDFCDIAYHFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQ 313

  Fly   299 FLLAHAVANRNIDVDYKLVAQNQTKVTRSPGAYVYQEIRNWPHF 342
            .|:..|||...:..:|.|:..:......|||..:|..|:.||||
Mouse   314 SLIQCAVAKGYLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 40/146 (27%)
Pglyrp3XP_006501534.1 PGRP 40..172 CDD:128941
PGRP 197..337 CDD:128941 42/152 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.