DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LALBA and LysS

DIOPT Version :9

Sequence 1:NP_001371279.1 Gene:LALBA / 3906 HGNCID:6480 Length:142 Species:Homo sapiens
Sequence 2:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster


Alignment Length:125 Identity:41/125 - (32%)
Similarity:67/125 - (53%) Gaps:4/125 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAI--VEN 63
            |:.|..|.|:.|..||:..:...:|.|::.:.|: |.....|.:..|...|.|.|.|..:  ..:
  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADL-GVPRDQLDKWTCIAQHESDYRTWVVGPANS 64

Human    64 NESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYW 123
            :.|.:||:|||::..||::.. ..|.|.|.:||:..|.||||:.:.||:|:|..:|...|
  Fly    65 DGSNDYGIFQINDLYWCQADG-RFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAW 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LALBANP_001371279.1 Lys 20..138 CDD:395016 34/106 (32%)
LysSNP_476829.1 LYZ1 20..140 CDD:197612 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.