DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and AKR1

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_010550.1 Gene:AKR1 / 851857 SGDID:S000002672 Length:764 Species:Saccharomyces cerevisiae


Alignment Length:401 Identity:78/401 - (19%)
Similarity:140/401 - (34%) Gaps:116/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKDDLRRFIHWGPITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSL 69
            |:..|...:.:|  |||.:|::..:.|:        |.:..:......|:.:......|.|.:.:
Yeast   383 LRSPLLSGVFFG--TLLWVTIVWFFKVM--------PRTFSDEQYTNILMLVILVSVFYLFGQLV 437

  Fly    70 MVGPGFVPLKW-HPQL--------------TKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMD 119
            ::.||.:|.:. |..:              ||:     ||......|..||......|..|.:.|
Yeast   438 IMDPGCLPEETDHENVRQTISNLLEIGKFDTKN-----FCIETWIRKPLRSKFSPLNNAVVARFD 497

  Fly   120 HHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMATVHLTQT 184
            |:||||...||..|..:|::|:....|     ||....|:        .:.| ...:...|...:
Yeast   498 HYCPWIFNDVGLKNHKAFIFFITLMES-----GIFTFLAL--------CLEY-FDELEDAHEDTS 548

  Fly   185 NLLACVFSLG----------------VIMGTVLASI---KLLYMQMKSILKNQTEIE-NWIVKKA 229
            ......|.||                :::..:|.||   .|:::|...|.|..|..| |.::|::
Yeast   549 QKNGKCFILGASDLCSGLIYDRFVFLILLWALLQSIWVASLIFVQAFQICKGMTNTEFNVLMKES 613

  Fly   230 AFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFSTGDGISWPVLPDCNEYSLTCEQLQQKKDKRAR 294
                     |.|.|....:|        |.|.:|.:|.:..:.|...........:.....::.|
Yeast   614 ---------KSIGPDGLSFN--------ENFNTTPEGFAPSIDPGEESNDTVLAPVPGSTIRKPR 661

  Fly   295 TRVFRC------------------IRPATGHWVPIFSQGLWVSLQIPCTDDPRIALKPDDIIHVT 341
            |....|                  |:.:|||  .::|    ::.:||.....:           .
Yeast   662 TCFGVCYAVTGMDQWLAVIKETIGIKDSTGH--NVYS----ITSRIPTNYGWK-----------R 709

  Fly   342 RIQEYWLYGEI 352
            .::::||..:|
Yeast   710 NVKDFWLTSDI 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 36/155 (23%)
AKR1NP_010550.1 ANK repeat 75..101 CDD:293786
ANKYR 78..270 CDD:223738
ANK repeat 103..140 CDD:293786
ANK repeat 142..173 CDD:293786
ANK repeat 213..244 CDD:293786
ANK repeat 246..271 CDD:293786
COG5273 363..725 CDD:227598 78/401 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.