DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and SWF1

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:71/311 - (22%)
Similarity:120/311 - (38%) Gaps:94/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKDD--LRRFIHWGPITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIR 67
            |.||  .|..:|..|:...::.|.:.:| .||.         :||.:...|..::..     .|.
Yeast    41 LVDDQKYRWKLHLVPLFYTSIYLYLVYT-YHMR---------VESTIKNELFLLERI-----LIV 90

  Fly    68 SLMVGP----GFVPLKWHPQLTKDKM----------FLQF-----CTRCNGYKAPRSHHCRRCNR 113
            .:::.|    |.:.:....:.:||..          :|.:     |:.|...|..||.||..|||
Yeast    91 PIIILPPVALGILAMVSRAEDSKDHKSGSTEEYPYDYLLYYPAIKCSTCRIVKPARSKHCSICNR 155

  Fly   114 CVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIKKRWLIRYGLRHMAT 178
            ||:..||||.|||.|:|..|   ::.|.||.:|.        :.::.....:.|.|        :
Yeast   156 CVLVADHHCIWINNCIGKGN---YLQFYLFLISN--------IFSMCYAFLRLWYI--------S 201

  Fly   179 VHLTQTNLLACVFSLGVIMG--TVLASIKLLYMQMKSILKNQT--EIENWIVKKAAFRRNAYPRK 239
            ::.|.| |...|.:|.::.|  |::.:| ..|:|:..:.:..|  |.:.|      :....|.|:
Yeast   202 LNSTST-LPRAVLTLTILCGCFTIICAI-FTYLQLAIVKEGMTTNEQDKW------YTIQEYMRE 258

  Fly   240 GIKPFVYPYNLGWKTNMREVFFSTGDGISWPVLPDCNEYSLTCEQLQQKKD 290
            |                 ::..|..|        ||..:...|  .:||.|
Yeast   259 G-----------------KLVRSLDD--------DCPSWFFKC--TEQKDD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 41/154 (27%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 71/311 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.