DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4483 and ZDHHC12

DIOPT Version :9

Sequence 1:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001304944.2 Gene:ZDHHC12 / 84885 HGNCID:19159 Length:322 Species:Homo sapiens


Alignment Length:287 Identity:74/287 - (25%)
Similarity:114/287 - (39%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCIKLKDDLRRFIHWGPITL-LTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYN 64
            :|.....:||::...|.:.| ||..|:|                               .|:|..
Human    82 LCSPASPELRQWEEQGELLLPLTFLLLV-------------------------------LGSLLL 115

  Fly    65 FIRSLMVGPGFVPLKWHPQ---------LTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDH 120
            ::...::.||:|.::..||         :....:.|:.|..|...:..|:.|||.|.|||.:.||
Human   116 YLAVSLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDH 180

  Fly   121 HCPWINTCVGWSNQDSFVYFLLFFMSGSIHGGIIIVSAVIRGIK-----KRWLIRYGLRHMATVH 180
            ||||:..|||..|...||.:|...:...:.|..:..|    |::     .:||...||       
Human   181 HCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLAWS----GLRFFQPWGQWLRSSGL------- 234

  Fly   181 LTQTNLLACVFSLGVIMGTVLASIKLLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFV 245
            |..|.||..:|||       :||: ||...:..:..|.|   .|  :..:..|.||.|:  :| .
Human   235 LFATFLLLSLFSL-------VASL-LLVSHLYLVASNTT---TW--EFISSHRIAYLRQ--RP-S 283

  Fly   246 YPYNLGWKTNMREVFFSTGDGISWPVL 272
            .|::.|...|:...|.....| ||..|
Human   284 NPFDRGLTRNLAHFFCGWPSG-SWETL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 44/140 (31%)
ZDHHC12NP_001304944.2 DHHC <178..272 CDD:388695 34/117 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.